Recombinant Human CCDC74B Protein, GST-tagged
| Cat.No. : | CCDC74B-5205H | 
| Product Overview : | Human CCDC74B full-length ORF ( AAH67771.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | CCDC74B (Coiled-Coil Domain Containing 74B) is a Protein Coding gene. An important paralog of this gene is CCDC74A. | 
| Molecular Mass : | 61.5 kDa | 
| AA Sequence : | MSGAGVAAGTRPPSSPTPGSRRRRQRPSVGVQSLRPQSPQLRQSDPQKRNLDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLRYKLIMNQTSQKKDSLSTSSFQSVKSISNSGKARPQPGSFNKQDSKADVPQKADLEEEPLLHNSKLDKVPGVQGQARKEKAEASNAGAACMGNSQHQGRQMGAAAHPPMILPLPLRKPTTLRQCEVLIRELWNTNLLQTQELQHLKSLLEGSQRPQAVPEEASFPRDQEATHFPKVSTKSLSKKCLLLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRLHRSVL | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CCDC74B coiled-coil domain containing 74B [ Homo sapiens (human) ] | 
| Official Symbol | CCDC74B | 
| Synonyms | CCDC74B; coiled-coil domain containing 74B; coiled-coil domain-containing protein 74B | 
| Gene ID | 91409 | 
| mRNA Refseq | NM_001258307 | 
| Protein Refseq | NP_001245236 | 
| UniProt ID | Q96LY2 | 
| ◆ Recombinant Proteins | ||
| CCDC74B-8378Z | Recombinant Zebrafish CCDC74B | +Inquiry | 
| CCDC74B-3831HF | Recombinant Full Length Human CCDC74B Protein, GST-tagged | +Inquiry | 
| CCDC74B-5205H | Recombinant Human CCDC74B Protein, GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC74B Products
Required fields are marked with *
My Review for All CCDC74B Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            