Recombinant Full Length Human CCK Protein, GST-tagged
| Cat.No. : | CCK-2917HF |
| Product Overview : | Human CCK full-length ORF (AAH08283, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 115 amino acids |
| Description : | This gene encodes a member of the gastrin/cholecystokinin family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake. A sulfated form of cholecystokinin-8 may modulate neuronal activity in the brain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015] |
| Molecular Mass : | 38.39 kDa |
| AA Sequence : | MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCK cholecystokinin [ Homo sapiens ] |
| Official Symbol | CCK |
| Synonyms | CCK; cholecystokinin; MGC117187; |
| Gene ID | 885 |
| mRNA Refseq | NM_000729 |
| Protein Refseq | NP_000720 |
| MIM | 118440 |
| UniProt ID | P06307 |
| ◆ Recombinant Proteins | ||
| CCK-1207R | Recombinant Rat CCK Protein | +Inquiry |
| Cck-7727M | Recombinant Mouse Cck protein, His & GST-tagged | +Inquiry |
| CCK-2917HF | Recombinant Full Length Human CCK Protein, GST-tagged | +Inquiry |
| CCK-1137C | Recombinant Chicken CCK | +Inquiry |
| CCK-370C | Recombinant Cynomolgus CCK Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCK-7737HCL | Recombinant Human CCK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCK Products
Required fields are marked with *
My Review for All CCK Products
Required fields are marked with *
