Recombinant Full Length Human CCNB1IP1 Protein, GST-tagged
Cat.No. : | CCNB1IP1-2960HF |
Product Overview : | Human CCNB1IP1 full-length ORF (NP_878269.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 277 amino acids |
Description : | HEI10 is a member of the E3 ubiquitin ligase family and functions in progression of the cell cycle through G(2)/M.[supplied by OMIM, Apr 2004] |
Molecular Mass : | 57.9 kDa |
AA Sequence : | MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCNB1IP1 cyclin B1 interacting protein 1, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | CCNB1IP1 |
Synonyms | CCNB1IP1; cyclin B1 interacting protein 1, E3 ubiquitin protein ligase; C14orf18, chromosome 14 open reading frame 18, cyclin B1 interacting protein 1; E3 ubiquitin-protein ligase CCNB1IP1; HEI10; human enhancer of invasion 10; enhancer of invasion 10; cyclin-B1-interacting protein 1; C14orf18; |
Gene ID | 57820 |
mRNA Refseq | NM_021178 |
Protein Refseq | NP_067001 |
MIM | 608249 |
UniProt ID | Q9NPC3 |
◆ Recombinant Proteins | ||
CCNB1IP1-1401M | Recombinant Mouse CCNB1IP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNB1IP1-2995H | Recombinant Human CCNB1IP1 Protein, His-tagged | +Inquiry |
CCNB1IP1-2960HF | Recombinant Full Length Human CCNB1IP1 Protein, GST-tagged | +Inquiry |
CCNB1IP1-2984M | Recombinant Mouse CCNB1IP1 Protein | +Inquiry |
CCNB1IP1-0652H | Recombinant Human CCNB1IP1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNB1IP1-7717HCL | Recombinant Human CCNB1IP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCNB1IP1 Products
Required fields are marked with *
My Review for All CCNB1IP1 Products
Required fields are marked with *
0
Inquiry Basket