Recombinant Human CCNB1IP1 Protein, GST-Tagged

Cat.No. : CCNB1IP1-0652H
Product Overview : Human CCNB1IP1 full-length ORF (NP_878269.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HEI10 is a member of the E3 ubiquitin ligase family and functions in progression of the cell cycle through G(2)/M.[supplied by OMIM, Apr 2004]
Molecular Mass : 57.9 kDa
AA Sequence : MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCNB1IP1 cyclin B1 interacting protein 1, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol CCNB1IP1
Synonyms CCNB1IP1; cyclin B1 interacting protein 1, E3 ubiquitin protein ligase; C14orf18, chromosome 14 open reading frame 18, cyclin B1 interacting protein 1; E3 ubiquitin-protein ligase CCNB1IP1; HEI10; human enhancer of invasion 10; enhancer of invasion 10; cyclin-B1-interacting protein 1; C14orf18;
Gene ID 57820
mRNA Refseq NM_021178
Protein Refseq NP_067001
MIM 608249
UniProt ID Q9NPC3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCNB1IP1 Products

Required fields are marked with *

My Review for All CCNB1IP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon