Recombinant Full Length Human CCNJ Protein, GST-tagged
| Cat.No. : | CCNJ-2979HF | 
| Product Overview : | Human CCNJ full-length ORF (AAH43175, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 372 amino acids | 
| Description : | CCNJ (Cyclin J) is a Protein Coding gene. An important paralog of this gene is CCNJL. | 
| Molecular Mass : | 66.66 kDa | 
| AA Sequence : | MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPTSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHYPCITPCFER | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CCNJ cyclin J [ Homo sapiens ] | 
| Official Symbol | CCNJ | 
| Synonyms | CCNJ; cyclin J; cyclin-J; bA690P14.1; FLJ10895; | 
| Gene ID | 54619 | 
| mRNA Refseq | NM_001134375 | 
| Protein Refseq | NP_001127847 | 
| UniProt ID | Q5T5M9 | 
| ◆ Recombinant Proteins | ||
| CCNJ-1411M | Recombinant Mouse CCNJ Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CCNJ-2999M | Recombinant Mouse CCNJ Protein | +Inquiry | 
| CCNJ-2979HF | Recombinant Full Length Human CCNJ Protein, GST-tagged | +Inquiry | 
| CCNJ-0676H | Recombinant Human CCNJ Protein, GST-Tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CCNJ-7703HCL | Recombinant Human CCNJ 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNJ Products
Required fields are marked with *
My Review for All CCNJ Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            