Recombinant Full Length Human CCNJ Protein, GST-tagged

Cat.No. : CCNJ-2979HF
Product Overview : Human CCNJ full-length ORF (AAH43175, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 372 amino acids
Description : CCNJ (Cyclin J) is a Protein Coding gene. An important paralog of this gene is CCNJL.
Molecular Mass : 66.66 kDa
AA Sequence : MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPTSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHYPCITPCFER
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCNJ cyclin J [ Homo sapiens ]
Official Symbol CCNJ
Synonyms CCNJ; cyclin J; cyclin-J; bA690P14.1; FLJ10895;
Gene ID 54619
mRNA Refseq NM_001134375
Protein Refseq NP_001127847
UniProt ID Q5T5M9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCNJ Products

Required fields are marked with *

My Review for All CCNJ Products

Required fields are marked with *

0
cart-icon
0
compare icon