Recombinant Human CCNJ Protein, GST-Tagged
Cat.No. : | CCNJ-0676H |
Product Overview : | Human CCNJ full-length ORF (AAH43175, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CCNJ (Cyclin J) is a Protein Coding gene. An important paralog of this gene is CCNJL. |
Molecular Mass : | 66.66 kDa |
AA Sequence : | MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPTSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHYPCITPCFER |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCNJ cyclin J [ Homo sapiens ] |
Official Symbol | CCNJ |
Synonyms | CCNJ; cyclin J; cyclin-J; bA690P14.1; FLJ10895; |
Gene ID | 54619 |
mRNA Refseq | NM_001134375 |
Protein Refseq | NP_001127847 |
UniProt ID | Q5T5M9 |
◆ Recombinant Proteins | ||
CCNJ-2979HF | Recombinant Full Length Human CCNJ Protein, GST-tagged | +Inquiry |
CCNJ-2999M | Recombinant Mouse CCNJ Protein | +Inquiry |
CCNJ-1411M | Recombinant Mouse CCNJ Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNJ-0676H | Recombinant Human CCNJ Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNJ-7703HCL | Recombinant Human CCNJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNJ Products
Required fields are marked with *
My Review for All CCNJ Products
Required fields are marked with *