Recombinant Human CCNJ Protein, GST-Tagged

• Cat.No.: CCNJ-0676H
• Product Overview: Human CCNJ full-length ORF (AAH43175, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CCNJ (Cyclin J) is a Protein Coding gene. An important paralog of this gene is CCNJL.
• Molecular Mass: 66.66 kDa
• AA Sequence: MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPTSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHYPCITPCFER
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCNJ cyclin J [ Homo sapiens ]
• Official Symbol: CCNJ
• Synonyms: CCNJ; cyclin J; cyclin-J; bA690P14.1; FLJ10895
• Gene ID: 54619
• mRNA Refseq: NM_001134375
• Protein Refseq: NP_001127847
• UniProt ID: Q5T5M9