Recombinant Full Length Human CCR7 Protein
| Cat.No. : | CCR7-3021HF |
| Product Overview : | Human CCR7 full-length ORF (NP_001829.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 742 amino acids |
| Description : | The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2014] |
| Form : | Liquid |
| Molecular Mass : | 42.9 kDa |
| AA Sequence : | MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP |
| Applications : | Antibody Production Functional Study Compound Screening |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | CCR7 chemokine (C-C motif) receptor 7 [ Homo sapiens ] |
| Official Symbol | CCR7 |
| Synonyms | CCR7; chemokine (C-C motif) receptor 7; CMKBR7, EBI1; C-C chemokine receptor type 7; BLR2; CD197; CDw197; CCR-7; CC-CKR-7; C-C CKR-7; MIP-3 beta receptor; CC chemokine receptor 7; chemokine (C-C) receptor 7; Epstein-Barr virus induced gene 1; EBV-induced G protein-coupled receptor 1; EBV-induced G-protein coupled receptor 1; Epstein-Barr virus induced G-protein coupled receptor; lymphocyte-specific G protein-coupled peptide receptor; epstein-Barr virus-induced G-protein coupled receptor 1; EBI1; CMKBR7; |
| Gene ID | 1236 |
| mRNA Refseq | NM_001838 |
| Protein Refseq | NP_001829 |
| MIM | 600242 |
| UniProt ID | P32248 |
| ◆ Recombinant Proteins | ||
| CCR7-854H | Active Recombinant Human CCR7 Full Length Transmembrane protein, His-tagged(Nanodisc) | +Inquiry |
| CCR7-5705Z | Recombinant Zebrafish CCR7 | +Inquiry |
| CCR7-213H | Recombinant Human CCR7 Protein, His-tagged | +Inquiry |
| CCR7-856H | Active Recombinant Human CCR7 Full Length Transmembrane protein(VLP) | +Inquiry |
| CCR7-875HFL | Recombinant Full Length Human CCR7 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCR7 Products
Required fields are marked with *
My Review for All CCR7 Products
Required fields are marked with *



