Recombinant Full Length Human CCR7 Protein, C-Flag-tagged
| Cat.No. : | CCR7-875HFL |
| Product Overview : | Recombinant Full Length Human CCR7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 40.2 kDa |
| AA Sequence : | MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICF VGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSF FSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRC SLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYN GVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQE QLRQWSSCRHIRRSSMSVEAETTTTFSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, GPCR, Transmembrane |
| Protein Pathways : | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
| Full Length : | Full L. |
| Gene Name | CCR7 C-C motif chemokine receptor 7 [ Homo sapiens (human) ] |
| Official Symbol | CCR7 |
| Synonyms | BLR2; EBI1; CCR-7; CD197; CDw197; CMKBR7; CC-CKR-7 |
| Gene ID | 1236 |
| mRNA Refseq | NM_001838.4 |
| Protein Refseq | NP_001829.1 |
| MIM | 600242 |
| UniProt ID | P32248 |
| ◆ Recombinant Proteins | ||
| CCR7-379C | Recombinant Cynomolgus CCR7 Protein, His-tagged | +Inquiry |
| CCR7-472H | Recombinant Human CCR7 protein, hFc-tagged | +Inquiry |
| CCR7-3021HF | Recombinant Full Length Human CCR7 Protein | +Inquiry |
| CCR7-8435H | Recombinant Human CCR7 Full Length Transmembrane protein(Nanodisc), His-tagged, FITC labeled | +Inquiry |
| CCR7-710R | Recombinant Rhesus monkey CCR7 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCR7 Products
Required fields are marked with *
My Review for All CCR7 Products
Required fields are marked with *
