Recombinant Full Length Human CD36 Protein
Cat.No. : | CD36-3166HF |
Product Overview : | Human CD36 full-length ORF (NP_000063.2) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 506 amino acids |
Description : | The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2014] |
Form : | Liquid |
Molecular Mass : | 53.1 kDa |
AA Sequence : | MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK |
Applications : | Antibody Production Functional Study Compound Screening |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CD36 CD36 molecule (thrombospondin receptor) [ Homo sapiens ] |
Official Symbol | CD36 |
Synonyms | CD36; CD36 molecule (thrombospondin receptor); CD36 antigen (collagen type I receptor, thrombospondin receptor); platelet glycoprotein 4; FAT; GP3B; GP4; GPIV; SCARB3; GPIIIB; PAS IV; PAS-4 protein; glycoprotein IIIb; cluster determinant 36; fatty acid translocase; platelet glycoprotein IV; scavenger receptor class B, member 3; leukocyte differentiation antigen CD36; CHDS7; PASIV; BDPLT10; |
Gene ID | 948 |
mRNA Refseq | NM_000072 |
Protein Refseq | NP_000063 |
MIM | 173510 |
UniProt ID | P16671 |
◆ Recombinant Proteins | ||
CD36-1282H | Recombinant Human CD36 protein, His-GST-tagged | +Inquiry |
CD36-3166HF | Recombinant Full Length Human CD36 Protein | +Inquiry |
CD36-3184H | Recombinant Human CD36 protein(Gly30-Asn439), His-tagged | +Inquiry |
CD36-96C | Recombinant Cynomolgus CD36, Fc-tagged | +Inquiry |
Cd36-3324M | Recombinant Mouse Cd36(Gly30Lys439) Protein, C-Avi-6*His-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD36-1236RCL | Recombinant Rat CD36 cell lysate | +Inquiry |
CD36-2400MCL | Recombinant Mouse CD36 cell lysate | +Inquiry |
CD36-2539HCL | Recombinant Human CD36 cell lysate | +Inquiry |
CD36-1109CCL | Recombinant Cynomolgus CD36 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD36 Products
Required fields are marked with *
My Review for All CD36 Products
Required fields are marked with *
0
Inquiry Basket