Recombinant Full Length Human CD40 Protein, GST tagged
Cat.No. : | CD40-2964HF |
Product Overview : | Recombinant Full Length Human CD40 Protein with GST tag was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Description : | This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. |
Molecular Mass : | The protein has a calculated MW of 48 kDa. |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKFERQHMDSPDLGTGGGSGDDDDKSPMVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHFHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIDICQPHFPKDRGLNLLM |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.01 mg/mL by BCA |
Storage Buffer : | Sterile 20 mM Tris, 200 mM NaCl, 5 mM EDTA, pH 8.0 |
Full Length : | Full L. |
Gene Name | CD40 CD40 molecule, TNF receptor superfamily member 5 [ Homo sapiens (human) ] |
Official Symbol | CD40 |
Synonyms | CD40; CD40 molecule, TNF receptor superfamily member 5; TNFRSF5, tumor necrosis factor receptor superfamily, member 5; tumor necrosis factor receptor superfamily member 5; Bp50; p50; CD40L receptor; CD40 type II isoform; B cell-associated molecule; B cell surface antigen CD40; B-cell surface antigen CD40; CD40 antigen (TNF receptor superfamily member 5); tumor necrosis factor receptor superfamily, member 5; nerve growth factor receptor-related B-lymphocyte activation molecule; CDW40; TNFRSF5; MGC9013 |
Gene ID | 958 |
mRNA Refseq | NM_001250 |
Protein Refseq | NP_001241 |
MIM | 109535 |
UniProt ID | P25942 |
◆ Recombinant Proteins | ||
CD40-2151R | Active Recombinant Rabbit CD40 protein, His-tagged | +Inquiry |
CD40-2221HAF555 | Recombinant Human CD40 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD40-174HF | Recombinant Human CD40 Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
CD40-167CF | Recombinant Canine CD40 Protein, Fc-tagged, FITC conjugated | +Inquiry |
CD40-630M | Recombinant Mouse CD40 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD40-001CCL | Recombinant Canine CD40 cell lysate | +Inquiry |
CD40-1262RCL | Recombinant Rat CD40 cell lysate | +Inquiry |
CD40-1254CCL | Recombinant Cynomolgus CD40 cell lysate | +Inquiry |
CD40-2617HCL | Recombinant Human CD40 cell lysate | +Inquiry |
CD40-1831MCL | Recombinant Mouse CD40 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD40 Products
Required fields are marked with *
My Review for All CD40 Products
Required fields are marked with *