Recombinant Full Length Human CD48 Protein, GST-tagged
| Cat.No. : | CD48-2998HF |
| Product Overview : | Human CD48 full-length ORF (AAH30224, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 169 amino acids |
| Description : | This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
| Molecular Mass : | 44.33 kDa |
| AA Sequence : | MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGEEERKTSGQV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CD48 CD48 molecule [ Homo sapiens ] |
| Official Symbol | CD48 |
| Synonyms | CD48; CD48 molecule; BCM1, CD48 antigen (B cell membrane protein), CD48 molecule; CD48 antigen; BLAST; hCD48; mCD48; SLAMF2; TCT.1; BCM1 surface antigen; leukocyte antigen MEM-102; B-lymphocyte activation marker BLAST-1; CD48 antigen (B-cell membrane protein); BCM1; BLAST1; MEM-102; |
| Gene ID | 962 |
| mRNA Refseq | NM_001256030 |
| Protein Refseq | NP_001242959 |
| MIM | 109530 |
| UniProt ID | P09326 |
| ◆ Recombinant Proteins | ||
| CD48-720M | Recombinant Mouse CD48 Protein | +Inquiry |
| CD48-838H | Recombinant Human CD48 Protein, Fc/His-tagged | +Inquiry |
| Cd48-8763RAF647 | Recombinant Rat Cd48 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| CD48-914R | Recombinant Rat CD48 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD48-252HAF488 | Recombinant Human CD48 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD48-3044HCL | Recombinant Human CD48 cell lysate | +Inquiry |
| CD48-1258RCL | Recombinant Rat CD48 cell lysate | +Inquiry |
| CD48-2468MCL | Recombinant Mouse CD48 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD48 Products
Required fields are marked with *
My Review for All CD48 Products
Required fields are marked with *
