Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Full Length Human CD79B Protein

Cat.No. : CD79B-66HF
Product Overview : Recombinant full length Human CD79b with N terminal proprietary tag; Predicted MWt 50.60 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 50.600kDa inclusive of tags
Protein Length : 229 amino acids
AA Sequence : MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKG SACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQ EMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDG IIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLD IDQTATYEDIVTLRTGEVKWSVGEHPGQE
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ]
Official Symbol : CD79B
Synonyms : CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29
Gene ID : 974
mRNA Refseq : NM_000626
Protein Refseq : NP_000617
MIM : 147245
UniProt ID : P40259

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
How does CD79B-targeted immunotherapy differ from traditional chemotherapy in treating B cell malignancies? 03/27/2021

CD79B-targeted immunotherapy aims to specifically target B cells, potentially reducing side effects compared to non-specific chemotherapy.

How does CD79B contribute to the development of personalized treatment strategies for B cell diseases? 01/12/2021

Analyzing CD79B expression helps tailor treatment plans, allowing for more personalized and effective approaches.

Can CD79B be used as a biomarker for minimal residual disease in B cell malignancies? 05/13/2018

Yes, monitoring CD79B levels can aid in detecting minimal residual disease, providing insights into treatment response.

Are there any challenges or limitations associated with relying on CD79B as a diagnostic marker? 03/02/2017

Variability in CD79B expression among different B cell disorders may pose challenges in its use as a standalone diagnostic marker.

Are there any clinical trials investigating the therapeutic potential of CD79B-targeted drugs? 01/22/2016

Yes, several clinical trials are exploring the efficacy of CD79B-targeted drugs in various B cell disorders.

Customer Reviews (3)

Write a review
Reviews
04/26/2023

    Renowned for its reliability and consistency, this protein offers researchers the confidence to achieve accurate and reproducible results in their studies.

    11/16/2021

      The CD79B protein comes highly recommended for its outstanding performance in ELISA assays.

      10/26/2018

        One notable advantage of the CD79B protein is the excellent technical support provided by its manufacturer.

        Ask a Question for All CD79B Products

        Required fields are marked with *

        My Review for All CD79B Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends