Recombinant Full Length Human CD79B Protein
| Cat.No. : | CD79B-66HF |
| Product Overview : | Recombinant full length Human CD79b with N terminal proprietary tag; Predicted MWt 50.60 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 229 amino acids |
| Description : | The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Form : | Liquid |
| Molecular Mass : | 50.600kDa inclusive of tags |
| AA Sequence : | MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKG SACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQ EMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDG IIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLD IDQTATYEDIVTLRTGEVKWSVGEHPGQE |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ] |
| Official Symbol | CD79B |
| Synonyms | CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29 |
| Gene ID | 974 |
| mRNA Refseq | NM_000626 |
| Protein Refseq | NP_000617 |
| MIM | 147245 |
| UniProt ID | P40259 |
| ◆ Recombinant Proteins | ||
| CD79B-0858H | Recombinant Human CD79B Protein, GST-Tagged | +Inquiry |
| CD79B-151H | Recombinant Human CD79B Protein, DYKDDDDK-tagged | +Inquiry |
| Cd79b-6897M | Recombinant Mouse Cd79b protein, His-tagged | +Inquiry |
| CD79B-3296H | Recombinant Human CD79B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CD79B-574R | Recombinant Rhesus Macaque CD79B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD79B-1827MCL | Recombinant Mouse CD79B cell lysate | +Inquiry |
| CD79B-1323RCL | Recombinant Rat CD79B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD79B Products
Required fields are marked with *
My Review for All CD79B Products
Required fields are marked with *



