Recombinant Full Length Human CD8B Protein
Cat.No. : | CD8B-65HF |
Product Overview : | Recombinant full length Human CD8 beta with a proprietary tag; Predicted MW 52.8 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 243 amino acids |
Description : | The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified. |
Form : | Liquid |
Molecular Mass : | 52.800kDa inclusive of tags |
AA Sequence : | MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CD8B CD8b molecule [ Homo sapiens ] |
Official Symbol | CD8B |
Synonyms | CD8B; CD8b molecule; CD8 antigen, beta polypeptide 1 (p37) , CD8B1; T-cell surface glycoprotein CD8 beta chain |
Gene ID | 926 |
mRNA Refseq | NM_001178100 |
Protein Refseq | NP_001171571 |
MIM | 186730 |
UniProt ID | P10966 |
◆ Recombinant Proteins | ||
CD8B-26H | Recombinant Human CD8B Protein, His-tagged | +Inquiry |
CD8B-3091HF | Recombinant Full Length Human CD8B Protein, GST-tagged | +Inquiry |
RFL22738PF | Recombinant Full Length Pongo Pygmaeus T-Cell Surface Glycoprotein Cd8 Beta Chain(Cd8B) Protein, His-Tagged | +Inquiry |
CD8B-1265R | Recombinant Rat CD8B Protein | +Inquiry |
CD8B-151H | Recombinant Human CD8B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD8B-001HCL | Recombinant Human CD8B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD8B Products
Required fields are marked with *
My Review for All CD8B Products
Required fields are marked with *
0
Inquiry Basket