Recombinant Full Length Human CDC37 Protein, C-Flag-tagged
Cat.No. : | CDC37-2013HFL |
Product Overview : | Recombinant Full Length Human CDC37 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is highly similar to Cdc 37, a cell division cycle control protein of Sacchromyces cerevisiae. This protein is a molecular chaperone with specific function in cell signal transduction. It has been shown to form complex with Hsp90 and a variety of protein kinases including CDK4, CDK6, SRC, RAF-1, MOK, as well as eIF2 alpha kinases. It is thought to play a critical role in directing Hsp90 to its target kinases. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.3 kDa |
AA Sequence : | MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRKVAECQRKLKE LEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKDGFSKSMVNTKPEKTEEDS EEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVA HQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEE EERKKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASE AKEGEEAGPGDPLLEAVPKTGDEKDVSV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CDC37 cell division cycle 37, HSP90 cochaperone [ Homo sapiens (human) ] |
Official Symbol | CDC37 |
Synonyms | P50CDC37 |
Gene ID | 11140 |
mRNA Refseq | NM_007065.4 |
Protein Refseq | NP_008996.1 |
MIM | 605065 |
UniProt ID | Q16543 |
◆ Recombinant Proteins | ||
CDC37-2210M | Recombinant Mouse CDC37 protein, His&GST-tagged | +Inquiry |
CDC37-555H | Recombinant Human CDC37 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC37-1275R | Recombinant Rat CDC37 Protein | +Inquiry |
CDC37-26222TH | Recombinant Human CDC37, His-tagged | +Inquiry |
CDC37-3124H | Recombinant Human CDC37 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC37-001MCL | Recombinant Mouse CDC37 cell lysate | +Inquiry |
CDC37-648HCL | Recombinant Human CDC37 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC37 Products
Required fields are marked with *
My Review for All CDC37 Products
Required fields are marked with *
0
Inquiry Basket