Recombinant Full Length Human CDC42EP1 Protein, GST-tagged
| Cat.No. : | CDC42EP1-3102HF |
| Product Overview : | Human CDC42EP1 full-length ORF (AAH09356, 1 a.a. - 384 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 384 amino acids |
| Description : | CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 67.98 kDa |
| AA Sequence : | MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAATPTGPAANPPAPAASSTPHGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDC42EP1 CDC42 effector protein (Rho GTPase binding) 1 [ Homo sapiens ] |
| Official Symbol | CDC42EP1 |
| Synonyms | CDC42EP1; CDC42 effector protein (Rho GTPase binding) 1; cdc42 effector protein 1; 55 kDa bone marrow stromal/endothelial cell protein; Borg5; CEP1; MSE55; serum constituent protein; serum protein MSE55; binder of Rho GTPases 5; BORG5; MGC15316; |
| Gene ID | 11135 |
| mRNA Refseq | NM_152243 |
| Protein Refseq | NP_689449 |
| MIM | 606084 |
| UniProt ID | Q00587 |
| ◆ Recombinant Proteins | ||
| CDC42EP1-3143M | Recombinant Mouse CDC42EP1 Protein | +Inquiry |
| CDC42EP1-0944H | Recombinant Human CDC42EP1 Protein, GST-Tagged | +Inquiry |
| CDC42EP1-1280R | Recombinant Rat CDC42EP1 Protein | +Inquiry |
| CDC42EP1-26804TH | Recombinant Human CDC42EP1, His-tagged | +Inquiry |
| CDC42EP1-1487M | Recombinant Mouse CDC42EP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDC42EP1-322HCL | Recombinant Human CDC42EP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC42EP1 Products
Required fields are marked with *
My Review for All CDC42EP1 Products
Required fields are marked with *
