Recombinant Full Length Human CDCA5 Protein, GST-tagged
Cat.No. : | CDCA5-3118HF |
Product Overview : | Human CDCA5 full-length ORF (NP_542399.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 252 amino acids |
Description : | CDCA5 (Cell Division Cycle Associated 5) is a Protein Coding gene. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Mitotic Metaphase and Anaphase. GO annotations related to this gene include chromatin binding. |
Molecular Mass : | 54 kDa |
AA Sequence : | MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDCA5 cell division cycle associated 5 [ Homo sapiens ] |
Official Symbol | CDCA5 |
Synonyms | CDCA5; cell division cycle associated 5; sororin; p35; cell division cycle-associated protein 5; SORORIN; MGC16386; |
Gene ID | 113130 |
mRNA Refseq | NM_080668 |
Protein Refseq | NP_542399 |
MIM | 609374 |
UniProt ID | Q96FF9 |
◆ Recombinant Proteins | ||
CDCA5-1498M | Recombinant Mouse CDCA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDCA5-0962H | Recombinant Human CDCA5 Protein, GST-Tagged | +Inquiry |
CDCA5-3118HF | Recombinant Full Length Human CDCA5 Protein, GST-tagged | +Inquiry |
CDCA5-5900Z | Recombinant Zebrafish CDCA5 | +Inquiry |
CDCA5-3157M | Recombinant Mouse CDCA5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDCA5-7641HCL | Recombinant Human CDCA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDCA5 Products
Required fields are marked with *
My Review for All CDCA5 Products
Required fields are marked with *
0
Inquiry Basket