Recombinant Full Length Human CDK5 Protein, GST-tagged
Cat.No. : | CDK5-3185HF |
Product Overview : | Human CDK5 full-length ORF (NP_004926.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 292 amino acids |
Description : | This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015] |
Molecular Mass : | 57.75 kDa |
AA Sequence : | MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDK5 cyclin-dependent kinase 5 [ Homo sapiens ] |
Official Symbol | CDK5 |
Synonyms | CDK5; cyclin-dependent kinase 5; PSSALRE; TPKII catalytic subunit; protein kinase CDK5 splicing; cell division protein kinase 5; serine/threonine-protein kinase PSSALRE; tau protein kinase II catalytic subunit; |
Gene ID | 1020 |
mRNA Refseq | NM_001164410 |
Protein Refseq | NP_001157882 |
MIM | 123831 |
UniProt ID | Q00535 |
◆ Recombinant Proteins | ||
CDK5-396H | Recombinant Human cyclin-dependent kinase 5, His-tagged | +Inquiry |
CDK5-236H | Recombinant Human CDK5 Protein, His-tagged | +Inquiry |
CDK5-965H | Recombinant Human CDK5 protein, GST-tagged | +Inquiry |
CDK5-1305R | Recombinant Rat CDK5 Protein | +Inquiry |
CDK5-1018H | Recombinant Human CDK5 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK5-7626HCL | Recombinant Human CDK5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All CDK5 Products
Required fields are marked with *
My Review for All CDK5 Products
Required fields are marked with *