Recombinant Full Length Human CDKAL1 Protein, GST-tagged
Cat.No. : | CDKAL1-3167HF |
Product Overview : | Human CDKAL1 full-length ORF (AAH64145.1, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 97 amino acids |
Description : | The protein encoded by this gene is a member of the methylthiotransferase family. The function of this gene is not known. Genome-wide association studies have linked single nucleotide polymorphisms in an intron of this gene with susceptibilty to type 2 diabetes. [provided by RefSeq, May 2010] |
Molecular Mass : | 37.4 kDa |
AA Sequence : | MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITGE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDKAL1 CDK5 regulatory subunit associated protein 1-like 1 [ Homo sapiens ] |
Official Symbol | CDKAL1 |
Synonyms | CDKAL1; CDK5 regulatory subunit associated protein 1-like 1; threonylcarbamoyladenosine tRNA methylthiotransferase; FLJ20342; tRNA-t(6)A37 methylthiotransferase; FLJ46705; MGC75469; |
Gene ID | 54901 |
mRNA Refseq | NM_017774 |
Protein Refseq | NP_060244 |
MIM | 611259 |
UniProt ID | Q5VV42 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDKAL1 Products
Required fields are marked with *
My Review for All CDKAL1 Products
Required fields are marked with *
0
Inquiry Basket