Recombinant Full Length Human CDKN1B Protein, C-Flag-tagged
Cat.No. : | CDKN1B-2041HFL |
Product Overview : | Recombinant Full Length Human CDKN1B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.9 kDa |
AA Sequence : | MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPL EGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDS QTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Cell cycle, Chronic myeloid leukemia, ErbB signaling pathway, Pathways in cancer, Prostate cancer, Small cell lung cancer |
Full Length : | Full L. |
Gene Name | CDKN1B cyclin dependent kinase inhibitor 1B [ Homo sapiens (human) ] |
Official Symbol | CDKN1B |
Synonyms | KIP1; MEN4; CDKN4; MEN1B; P27KIP1 |
Gene ID | 1027 |
mRNA Refseq | NM_004064.5 |
Protein Refseq | NP_004055.1 |
MIM | 600778 |
UniProt ID | P46527 |
◆ Recombinant Proteins | ||
CDKN1B-1954H | Recombinant Human CDKN1B protein, His-tagged | +Inquiry |
CDKN1B-4158H | Recombinant Human CDKN1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDKN1B-1076H | Recombinant Human CDKN1B Protein (Met1-Thr198), His tagged | +Inquiry |
CDKN1B-2041HFL | Recombinant Full Length Human CDKN1B Protein, C-Flag-tagged | +Inquiry |
CDKN1B-1056H | Recombinant Human CDKN1B Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN1B-7617HCL | Recombinant Human CDKN1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN1B Products
Required fields are marked with *
My Review for All CDKN1B Products
Required fields are marked with *
0
Inquiry Basket