Recombinant Full Length Human CDKN2B Protein, GST-tagged
Cat.No. : | CDKN2B-3229HF |
Product Overview : | Human CDKN2B full-length ORF (AAH14469, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 138 amino acids |
Description : | Entrez Gene Summary for CDKN2B Gene This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 40.92 kDa |
AA Sequence : | MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDKN2B cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) [ Homo sapiens ] |
Official Symbol | CDKN2B |
Synonyms | CDKN2B; cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4); cyclin-dependent kinase 4 inhibitor B; CDK4I; INK4B; MTS2; P15; p15INK4b; TP15; MTS-2; p14-INK4b; p14_INK4B; p15-INK4b; p15_INK4B; CDK4B inhibitor; p14_CDK inhibitor; p15 CDK inhibitor; CDK inhibitory protein; multiple tumor suppressor 2; cyclin-dependent kinases 4 and 6 binding protein; |
Gene ID | 1030 |
mRNA Refseq | NM_004936 |
Protein Refseq | NP_004927 |
MIM | 600431 |
UniProt ID | P42772 |
◆ Recombinant Proteins | ||
CDKN2B-974R | Recombinant Rat CDKN2B Protein, His (Fc)-Avi-tagged | +Inquiry |
CDKN2B-3229HF | Recombinant Full Length Human CDKN2B Protein, GST-tagged | +Inquiry |
CDKN2B-1064H | Recombinant Human CDKN2B Protein, GST-Tagged | +Inquiry |
CDKN2B-4212H | Recombinant Human CDKN2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDKN2B-2681H | Recombinant Human CDKN2B protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN2B-7613HCL | Recombinant Human CDKN2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN2B Products
Required fields are marked with *
My Review for All CDKN2B Products
Required fields are marked with *