Recombinant Human CDKN2B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CDKN2B-4212H |
Product Overview : | CDKN2B MS Standard C13 and N15-labeled recombinant protein (NP_511042) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. |
Molecular Mass : | 7.9 kDa |
AA Sequence : | MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVAGAPGPRRQGARERGARPRRIGAGTSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CDKN2B cyclin dependent kinase inhibitor 2B [ Homo sapiens (human) ] |
Official Symbol | CDKN2B |
Synonyms | CDKN2B; cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4); cyclin-dependent kinase 4 inhibitor B; CDK4I; INK4B; MTS2; P15; p15INK4b; TP15; MTS-2; p14-INK4b; p14_INK4B; p15-INK4b; p15_INK4B; CDK4B inhibitor; p14_CDK inhibitor; p15 CDK inhibitor; CDK inhibitory protein; multiple tumor suppressor 2; cyclin-dependent kinases 4 and 6 binding protein; |
Gene ID | 1030 |
mRNA Refseq | NM_078487 |
Protein Refseq | NP_511042 |
MIM | 600431 |
UniProt ID | P42772 |
◆ Recombinant Proteins | ||
CDKN2B-1540M | Recombinant Mouse CDKN2B Protein, His (Fc)-Avi-tagged | +Inquiry |
CDKN2B-1064H | Recombinant Human CDKN2B Protein, GST-Tagged | +Inquiry |
CDKN2B-4212H | Recombinant Human CDKN2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDKN2B-134H | Recombinant Human CDKN2B protein, His-tagged | +Inquiry |
CDKN2B-1316R | Recombinant Rat CDKN2B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN2B-7613HCL | Recombinant Human CDKN2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN2B Products
Required fields are marked with *
My Review for All CDKN2B Products
Required fields are marked with *