Recombinant Full Length Human CDKN2D Protein, GST-tagged
| Cat.No. : | CDKN2D-3233HF |
| Product Overview : | Human CDKN2D full-length ORF (AAH01822, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 166 amino acids |
| Description : | The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 44 kDa |
| AA Sequence : | MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDKN2D cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) [ Homo sapiens ] |
| Official Symbol | CDKN2D |
| Synonyms | CDKN2D; cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4); cyclin-dependent kinase 4 inhibitor D; INK4D; p19; CDK inhibitor p19INK4d; inhibitor of cyclin-dependent kinase 4d; cyclin-dependent kinase 4 inhibitor D p19; cell cycle inhibitor, Nur77 associating protein; p19-INK4D; |
| Gene ID | 1032 |
| mRNA Refseq | NM_001800 |
| Protein Refseq | NP_001791 |
| MIM | 600927 |
| UniProt ID | P55273 |
| ◆ Recombinant Proteins | ||
| Cdkn2d-1255M | Recombinant Mouse Cdkn2d protein, His & T7-tagged | +Inquiry |
| CDKN2D-1066H | Recombinant Human CDKN2D Protein, GST-Tagged | +Inquiry |
| CDKN2D-570H | Recombinant Human CDKN2D Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDKN2D-721HFL | Recombinant Full Length Human CDKN2D Protein, C-Flag-tagged | +Inquiry |
| CDKN2D-1254H | Recombinant Human CDKN2D protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDKN2D-7611HCL | Recombinant Human CDKN2D 293 Cell Lysate | +Inquiry |
| CDKN2D-7610HCL | Recombinant Human CDKN2D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN2D Products
Required fields are marked with *
My Review for All CDKN2D Products
Required fields are marked with *
