Recombinant Human CELF5 protein, His-tagged
Cat.No. : | CELF5-6743H |
Product Overview : | Recombinant Human CELF5 protein(135-485 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 135-485 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | KLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDPGHPY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CELF5 CUGBP, Elav-like family member 5 [ Homo sapiens ] |
Official Symbol | CELF5 |
Synonyms | CELF5; CUGBP, Elav-like family member 5; Bruno (Drosophila) like 5, RNA binding protein , bruno like 5, RNA binding protein (Drosophila) , BRUNOL5; CUGBP Elav-like family member 5; RNA-binding protein BRUNOL-5; CUG-BP and ETR-3 like factor 5; bruno-like 5 RNA binding protein; CELF-5; BRUNOL5; BRUNOL-5; |
Gene ID | 60680 |
mRNA Refseq | NM_001172673 |
Protein Refseq | NP_001166144 |
MIM | 612680 |
UniProt ID | Q8N6W0 |
◆ Recombinant Proteins | ||
CELF5-353H | Recombinant Human CELF5 Protein, GST-tagged | +Inquiry |
CELF5-3187H | Recombinant Human CELF5 Protein, MYC/DDK-tagged | +Inquiry |
CELF5-6743H | Recombinant Human CELF5 protein, His-tagged | +Inquiry |
CELF5-4465H | Recombinant Human CELF5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Celf5-2101M | Recombinant Mouse Celf5 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELF5-184HCL | Recombinant Human CELF5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CELF5 Products
Required fields are marked with *
My Review for All CELF5 Products
Required fields are marked with *