Recombinant Full Length Human CEP290 Protein, GST-tagged
Cat.No. : | CEP290-3231HF |
Product Overview : | Human Cep290 full-length ORF (AAH08641.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 164 amino acids |
Description : | This gene encodes a protein with 13 putative coiled-coil domains, a region with homology to SMC chromosome segregation ATPases, six KID motifs, three tropomyosin homology domains and an ATP/GTP binding site motif A. The protein is localized to the centrosome and cilia and has sites for N-glycosylation, tyrosine sulfation, phosphorylation, N-myristoylation, and amidation. Mutations in this gene have been associated with Joubert syndrome and nephronophthisis and the presence of antibodies against this protein is associated with several forms of cancer. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 45.6 kDa |
AA Sequence : | MAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAEV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEP290 centrosomal protein 290kDa [ Homo sapiens ] |
Official Symbol | CEP290 |
Synonyms | CEP290; centrosomal protein 290kDa; centrosomal protein of 290 kDa; 3H11Ag; BBS14; cancer/testis antigen 87; CT87; FLJ13615; JBTS5; Joubert syndrome 5; KIAA0373; LCA10; Meckel syndrome; type 4; MKS4; nephrocystin 6; NPHP6; POC3; POC3 centriolar protein homolog (Chlamydomonas); rd16; SLSN6; nephrocytsin-6; tumor antigen se2-2; Meckel syndrome, type 4; CTCL tumor antigen se2-2; prostate cancer antigen T21; POC3 centriolar protein homolog; Bardet-Biedl syndrome 14 protein; monoclonal 3H11 antigen; FLJ21979; |
Gene ID | 80184 |
mRNA Refseq | NM_025114 |
Protein Refseq | NP_079390 |
MIM | 610142 |
UniProt ID | O15078 |
◆ Recombinant Proteins | ||
CEP290-11112H | Recombinant Human CEP290, His-tagged | +Inquiry |
CEP290-3231HF | Recombinant Full Length Human CEP290 Protein, GST-tagged | +Inquiry |
CEP290-1134H | Recombinant Human CEP290 Protein, GST-Tagged | +Inquiry |
CEP290-7640Z | Recombinant Zebrafish CEP290 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEP290 Products
Required fields are marked with *
My Review for All CEP290 Products
Required fields are marked with *