Recombinant Full Length Human CEP57 Protein, GST-tagged
Cat.No. : | CEP57-3234HF |
Product Overview : | Human CEP57 full-length ORF (NP_055494.2, 1 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 500 amino acids |
Description : | This gene encodes a cytoplasmic protein called Translokin. This protein localizes to the centrosome and has a function in microtubular stabilization. The N-terminal half of this protein is required for its centrosome localization and for its multimerization, and the C-terminal half is required for nucleating, bundling and anchoring microtubules to the centrosomes. This protein specifically interacts with fibroblast growth factor 2 (FGF2), sorting nexin 6, Ran-binding protein M and the kinesins KIF3A and KIF3B, and thus mediates the nuclear translocation and mitogenic activity of the FGF2. It also interacts with cyclin D1 and controls nucleocytoplasmic distribution of the cyclin D1 in quiescent cells. This protein is crucial for maintaining correct chromosomal number during cell division. Mutations in this gene cause mosaic variegated aneuploidy syndrome, a rare autosomal recessive disorder. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 80.63 kDa |
AA Sequence : | MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEP57 centrosomal protein 57kDa [ Homo sapiens ] |
Official Symbol | CEP57 |
Synonyms | CEP57; centrosomal protein 57kDa; centrosomal protein of 57 kDa; KIAA0092; Translokin; TSP57; translokin; FGF2-interacting protein; testis-specific protein 57; proliferation-inducing protein 8; MVA2; PIG8; |
Gene ID | 9702 |
mRNA Refseq | NM_001243776 |
Protein Refseq | NP_001230705 |
MIM | 607951 |
UniProt ID | Q86XR8 |
◆ Recombinant Proteins | ||
CEP57-5154Z | Recombinant Zebrafish CEP57 | +Inquiry |
CEP57-1343R | Recombinant Rat CEP57 Protein | +Inquiry |
Cep57-743M | Recombinant Mouse Cep57 Protein, His-tagged | +Inquiry |
CEP57-3234HF | Recombinant Full Length Human CEP57 Protein, GST-tagged | +Inquiry |
CEP57-1591M | Recombinant Mouse CEP57 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEP57-7572HCL | Recombinant Human CEP57 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEP57 Products
Required fields are marked with *
My Review for All CEP57 Products
Required fields are marked with *
0
Inquiry Basket