Recombinant Full Length Human CERS2 Protein, C-Flag-tagged
Cat.No. : | CERS2-1295HFL |
Product Overview : | Recombinant Full Length Human CERS2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.7 kDa |
AA Sequence : | MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNI KEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRF TFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQI IHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVIL PFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSE GEEAAAGGGAKSRPLANGHPILNNNHRKNDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors, Transmembrane |
Full Length : | Full L. |
Gene Name | CERS2 ceramide synthase 2 [ Homo sapiens (human) ] |
Official Symbol | CERS2 |
Synonyms | L3; LASS2; SP260; TMSG1 |
Gene ID | 29956 |
mRNA Refseq | NM_181746.4 |
Protein Refseq | NP_859530.1 |
MIM | 606920 |
UniProt ID | Q96G23 |
◆ Recombinant Proteins | ||
Cers2-2121M | Recombinant Mouse Cers2 Protein, Myc/DDK-tagged | +Inquiry |
CERS2-1295HFL | Recombinant Full Length Human CERS2 Protein, C-Flag-tagged | +Inquiry |
RFL586HF | Recombinant Full Length Human Ceramide Synthase 2(Cers2) Protein, His-Tagged | +Inquiry |
CERS2-1277H | Recombinant Human CERS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CERS2-578H | Recombinant Human CERS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CERS2-4819HCL | Recombinant Human LASS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CERS2 Products
Required fields are marked with *
My Review for All CERS2 Products
Required fields are marked with *
0
Inquiry Basket