Recombinant Full Length Human CFL1 Protein, GST-tagged
Cat.No. : | CFL1-3296HF |
Product Overview : | Human CFL1 full-length ORF (AAH11005, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 166 amino acids |
Description : | The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM, Apr 2004] |
Molecular Mass : | 44 kDa |
AA Sequence : | MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CFL1 cofilin 1 (non-muscle) [ Homo sapiens ] |
Official Symbol | CFL1 |
Synonyms | CFL1; cofilin 1 (non-muscle); CFL; cofilin-1; p18; 18 kDa phosphoprotein; cofilin, non-muscle isoform; |
Gene ID | 1072 |
mRNA Refseq | NM_005507 |
Protein Refseq | NP_005498 |
MIM | 601442 |
UniProt ID | P23528 |
◆ Recombinant Proteins | ||
RFL7395CF | Recombinant Full Length Candida Albicans Probable Ferric Reductase Transmembrane Component(Cfl1) Protein, His-Tagged | +Inquiry |
CFL1-2153H | Recombinant Human CFL1 protein, His-tagged | +Inquiry |
CFL1-3350M | Recombinant Mouse CFL1 Protein | +Inquiry |
CFL1-26781TH | Recombinant Human CFL1 | +Inquiry |
CFL1-1041H | Recombinant Human CFL1 Protein (Ser3-Leu161), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFL1-7555HCL | Recombinant Human CFL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFL1 Products
Required fields are marked with *
My Review for All CFL1 Products
Required fields are marked with *