Recombinant Full Length Human CFL1 Protein, GST-tagged

Cat.No. : CFL1-3296HF
Product Overview : Human CFL1 full-length ORF (AAH11005, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 166 amino acids
Description : The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM, Apr 2004]
Molecular Mass : 44 kDa
AA Sequence : MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CFL1 cofilin 1 (non-muscle) [ Homo sapiens ]
Official Symbol CFL1
Synonyms CFL1; cofilin 1 (non-muscle); CFL; cofilin-1; p18; 18 kDa phosphoprotein; cofilin, non-muscle isoform;
Gene ID 1072
mRNA Refseq NM_005507
Protein Refseq NP_005498
MIM 601442
UniProt ID P23528

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFL1 Products

Required fields are marked with *

My Review for All CFL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon