Recombinant Full Length Human CGAS Protein, C-Flag-tagged
Cat.No. : | CGAS-165HFL |
Product Overview : | Recombinant Full Length Human CGAS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables several functions, including 2',3'-cyclic GMP-AMP synthase activity; chromatin binding activity; and phosphatidylinositol-4,5-bisphosphate binding activity. Involved in several processes, including cellular response to exogenous dsRNA; positive regulation of intracellular signal transduction; and regulation of defense response. Located in several cellular components, including cytosol; nucleus; and site of double-strand break. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 58.6 kDa |
AA Sequence : | MQPWHGKAMQRASEAGATAPKASARNARGAPMDPNESPAAPEAALPKAGKFGPARKSGSRQKKSAPDTQE RPPVRATGARAKKAPQRAQDTQPSDATSAPGAEGLEPPAAREPALSRAGSCRQRGARCSTKPRPPPGPWD VPSPGLPVSAPILVRRDAAPGASKLRAVLEKLKLSRDDISTAAGMVKGVVDHLLLRLKCDSAFRGVGLLN TGSYYEHVKISAPNEFDVMFKLEVPRIQLEEYSNTRAYYFVKFKRNPKENHLSQFLEGEILSASKMLSKF RKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEKISVDITLALESKSSWPASTQEGLRIQNWLSAKVRK QLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQL KERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNL FSSNLIDKRSKEFLTKQIEYERNNEFPVFDEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CGAS cyclic GMP-AMP synthase [ Homo sapiens (human) ] |
Official Symbol | CGAS |
Synonyms | MB21D1; h-cGAS; C6orf150 |
Gene ID | 115004 |
mRNA Refseq | NM_138441.3 |
Protein Refseq | NP_612450.2 |
MIM | 613973 |
UniProt ID | Q8N884 |
◆ Recombinant Proteins | ||
CGAS-1624H | Recombinant Human CGAS protein(Glu225~Cys405), His-tagged | +Inquiry |
CGAS-132H | Recombinant Human CGAS Protein, His-tagged | +Inquiry |
CGAS-0781H | Recombinant Human CGAS Protein (D157-F522), Flag tagged | +Inquiry |
CGAS-097H | Recombinant Human CGAS protein, His-tagged | +Inquiry |
CGAS-587H | Recombinant Human CGAS Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CGAS Products
Required fields are marked with *
My Review for All CGAS Products
Required fields are marked with *
0
Inquiry Basket