Recombinant Full Length Human CGAS Protein, C-Flag-tagged
| Cat.No. : | CGAS-165HFL |
| Product Overview : | Recombinant Full Length Human CGAS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables several functions, including 2',3'-cyclic GMP-AMP synthase activity; chromatin binding activity; and phosphatidylinositol-4,5-bisphosphate binding activity. Involved in several processes, including cellular response to exogenous dsRNA; positive regulation of intracellular signal transduction; and regulation of defense response. Located in several cellular components, including cytosol; nucleus; and site of double-strand break. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 58.6 kDa |
| AA Sequence : | MQPWHGKAMQRASEAGATAPKASARNARGAPMDPNESPAAPEAALPKAGKFGPARKSGSRQKKSAPDTQE RPPVRATGARAKKAPQRAQDTQPSDATSAPGAEGLEPPAAREPALSRAGSCRQRGARCSTKPRPPPGPWD VPSPGLPVSAPILVRRDAAPGASKLRAVLEKLKLSRDDISTAAGMVKGVVDHLLLRLKCDSAFRGVGLLN TGSYYEHVKISAPNEFDVMFKLEVPRIQLEEYSNTRAYYFVKFKRNPKENHLSQFLEGEILSASKMLSKF RKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEKISVDITLALESKSSWPASTQEGLRIQNWLSAKVRK QLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQL KERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNL FSSNLIDKRSKEFLTKQIEYERNNEFPVFDEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | CGAS cyclic GMP-AMP synthase [ Homo sapiens (human) ] |
| Official Symbol | CGAS |
| Synonyms | MB21D1; h-cGAS; C6orf150 |
| Gene ID | 115004 |
| mRNA Refseq | NM_138441.3 |
| Protein Refseq | NP_612450.2 |
| MIM | 613973 |
| UniProt ID | Q8N884 |
| ◆ Recombinant Proteins | ||
| CGAS-4650H | Recombinant Human CGAS protein, His-SUMO-tagged | +Inquiry |
| CGAS-165HFL | Recombinant Full Length Human CGAS Protein, C-Flag-tagged | +Inquiry |
| CGAS-9654H | Recombinant Human CGAS protein, His-tagged | +Inquiry |
| CGAS-6581H | Recombinant Human CGAS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CGAS-0782H | Recombinant Human CGAS Protein (D157-F522), His/MBP; Flag tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CGAS Products
Required fields are marked with *
My Review for All CGAS Products
Required fields are marked with *
