Recombinant Full Length Human CHAD Protein, GST-tagged
| Cat.No. : | CHAD-3308HF | 
| Product Overview : | Human CHAD full-length ORF (AAH36360.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 359 amino acids | 
| Description : | Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. The protein contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 65.89 kDa | 
| AA Sequence : | MVRPMLLLSLGLLAGLLPALAACPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CHAD chondroadherin [ Homo sapiens ] | 
| Official Symbol | CHAD | 
| Synonyms | CHAD; chondroadherin; chondroadherin proteoglycan; SLRR4A; cartilage leucine-rich protein; | 
| Gene ID | 1101 | 
| mRNA Refseq | NM_001267 | 
| Protein Refseq | NP_001258 | 
| MIM | 602178 | 
| UniProt ID | O15335 | 
| ◆ Recombinant Proteins | ||
| CHAD-3308HF | Recombinant Full Length Human CHAD Protein, GST-tagged | +Inquiry | 
| CHAD-3363M | Recombinant Mouse CHAD Protein | +Inquiry | 
| CHAD-1621M | Recombinant Mouse CHAD Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CHAD-1201H | Recombinant Human CHAD Protein, GST-Tagged | +Inquiry | 
| CHAD-67H | Recombinant Human CHAD, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CHAD-182HCL | Recombinant Human CHAD lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHAD Products
Required fields are marked with *
My Review for All CHAD Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            