Recombinant Full Length Human Chemokine Xc Receptor 1(Xcr1) Protein, His-Tagged
Cat.No. : | RFL19172HF |
Product Overview : | Recombinant Full Length Human Chemokine XC receptor 1(XCR1) Protein (P46094) (1-333aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-333) |
Form : | Lyophilized powder |
AA Sequence : | MESSGNPESTTFFYYDLQSQPCENQAWVFATLATTVLYCLVFLLSLVGNSLVLWVLVKYE SLESLTNIFILNLCLSDLVFACLLPVWISPYHWGWVLGDFLCKLLNMIFSISLYSSIFFL TIMTIHRYLSVVSPLSTLRVPTLRCRVLVTMAVWVASILSSILDTIFHKVLSSGCDYSEL TWYLTSVYQHNLFFLLSLGIILFCYVEILRTLFRSRSKRRHRTVKLIFAIVVAYFLSWGP YNFTLFLQTLFRTQIIRSCEAKQQLEYALLICRNLAFSHCCFNPVLYVFVGVKFRTHLKH VLRQFWFCRLQAPSPASIPHSPGAFAYEGASFY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | XCR1 |
Synonyms | XCR1; CCXCR1; GPR5; Chemokine XC receptor 1; G-protein coupled receptor 5; Lymphotactin receptor; XC chemokine receptor 1 |
UniProt ID | P46094 |
◆ Recombinant Proteins | ||
XCR1-3497C | Recombinant Chicken XCR1 | +Inquiry |
RFL11018MF | Recombinant Full Length Mouse Chemokine Xc Receptor 1(Xcr1) Protein, His-Tagged | +Inquiry |
Xcr1-585M | Recombinant Mouse Xcr1 protein, His-tagged | +Inquiry |
XCR1-0182H | Active Recombinant Human XCR1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
RFL19172HF | Recombinant Full Length Human Chemokine Xc Receptor 1(Xcr1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XCR1-266HCL | Recombinant Human XCR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XCR1 Products
Required fields are marked with *
My Review for All XCR1 Products
Required fields are marked with *
0
Inquiry Basket