Recombinant Full Length Human CHKB Protein
Cat.No. : | CHKB-78HF |
Product Overview : | Recombinant full length Human CHKL with a N terminal proprietary tag; Predicted MWt 69.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 395 amino acids |
Description : | Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus. |
Form : | Liquid |
Molecular Mass : | 69.520kDa inclusive of tags |
AA Sequence : | MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASS LSRDAERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSN LLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES VMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELRE PVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQ DLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCH NDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNH FCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEA KKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQ ASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CHKB choline kinase beta [ Homo sapiens ] |
Official Symbol | CHKB |
Synonyms | CHKB; choline kinase beta; CHKL, choline kinase like; choline/ethanolamine kinase; CHETK |
Gene ID | 1120 |
mRNA Refseq | NM_005198 |
Protein Refseq | NP_005189 |
MIM | 612395 |
UniProt ID | Q9Y259 |
◆ Recombinant Proteins | ||
Chkb-1726M | Recombinant Mouse Chkb protein, His-tagged | +Inquiry |
CHKB-1032R | Recombinant Rat CHKB Protein, His (Fc)-Avi-tagged | +Inquiry |
CHKB-3202HF | Recombinant Full Length Human CHKB Protein, GST-tagged | +Inquiry |
CHKB-1374R | Recombinant Rat CHKB Protein | +Inquiry |
CHKB-78HF | Recombinant Full Length Human CHKB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHKB-7534HCL | Recombinant Human CHKB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHKB Products
Required fields are marked with *
My Review for All CHKB Products
Required fields are marked with *
0
Inquiry Basket