Recombinant Full Length Human CHMP2B Protein
Cat.No. : | CHMP2B-79HF |
Product Overview : | Recombinant full length protein corresponding to amino acids 1-213 of Human CHMP2B with a propreitary tag; predicted mwt: 49.06 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 213 amino acids |
Description : | This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. |
Form : | Liquid |
Molecular Mass : | 49.060kDa inclusive of tags |
AA Sequence : | MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CHMP2B charged multivesicular body protein 2B [ Homo sapiens ] |
Official Symbol | CHMP2B |
Synonyms | CHMP2B; charged multivesicular body protein 2B; chromatin modifying protein 2B; charged multivesicular body protein 2b; CHMP2.5; DKFZP564O123; VPS2 homolog B (S. cerevisiae); VPS2B |
Gene ID | 25978 |
mRNA Refseq | NM_001244644 |
Protein Refseq | NP_001231573 |
MIM | 609512 |
UniProt ID | Q9UQN3 |
◆ Recombinant Proteins | ||
CHMP2B-27996TH | Recombinant Human CHMP2B | +Inquiry |
CHMP2B-4985H | Recombinant Human Chromatin Modifying Protein 2B, His-tagged | +Inquiry |
CHMP2B-2491C | Recombinant Chicken CHMP2B | +Inquiry |
Chmp2b-2147M | Recombinant Mouse Chmp2b Protein, Myc/DDK-tagged | +Inquiry |
CHMP2B-1250H | Recombinant Human CHMP2B Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP2B-185HCL | Recombinant Human CHMP2B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP2B Products
Required fields are marked with *
My Review for All CHMP2B Products
Required fields are marked with *