Recombinant Full Length Human CHMP2B Protein
| Cat.No. : | CHMP2B-79HF |
| Product Overview : | Recombinant full length protein corresponding to amino acids 1-213 of Human CHMP2B with a propreitary tag; predicted mwt: 49.06 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 213 amino acids |
| Description : | This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. |
| Form : | Liquid |
| Molecular Mass : | 49.060kDa inclusive of tags |
| AA Sequence : | MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | CHMP2B charged multivesicular body protein 2B [ Homo sapiens ] |
| Official Symbol | CHMP2B |
| Synonyms | CHMP2B; charged multivesicular body protein 2B; chromatin modifying protein 2B; charged multivesicular body protein 2b; CHMP2.5; DKFZP564O123; VPS2 homolog B (S. cerevisiae); VPS2B |
| Gene ID | 25978 |
| mRNA Refseq | NM_001244644 |
| Protein Refseq | NP_001231573 |
| MIM | 609512 |
| UniProt ID | Q9UQN3 |
| ◆ Recombinant Proteins | ||
| CHMP2B-1250H | Recombinant Human CHMP2B Protein, GST-Tagged | +Inquiry |
| CHMP2B-3406M | Recombinant Mouse CHMP2B Protein | +Inquiry |
| CHMP2B-27997TH | Recombinant Human CHMP2B, His-tagged | +Inquiry |
| Chmp2b-2147M | Recombinant Mouse Chmp2b Protein, Myc/DDK-tagged | +Inquiry |
| CHMP2B-3235H | Recombinant Human CHMP2B Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHMP2B-185HCL | Recombinant Human CHMP2B lysate | +Inquiry |
| CHMP2B-110HKCL | Human CHMP2B Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP2B Products
Required fields are marked with *
My Review for All CHMP2B Products
Required fields are marked with *



