Recombinant Full Length Human CHMP2B Protein

• Cat.No.: CHMP2B-79HF
• Product Overview: Recombinant full length protein corresponding to amino acids 1-213 of Human CHMP2B with a propreitary tag; predicted mwt: 49.06 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 213 amino acids
• Description: This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration.
• Form: Liquid
• Molecular Mass: 49.060kDa inclusive of tags
• AA Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: CHMP2B charged multivesicular body protein 2B [ Homo sapiens ]
• Official Symbol: CHMP2B
• Synonyms: CHMP2B; charged multivesicular body protein 2B; chromatin modifying protein 2B; charged multivesicular body protein 2b; CHMP2.5; DKFZP564O123; VPS2 homolog B (S. cerevisiae); VPS2B
• Gene ID: 25978
• mRNA Refseq: NM_001244644
• Protein Refseq: NP_001231573
• MIM: 609512
• UniProt ID: Q9UQN3