Recombinant Human CHMP2B Protein, GST-Tagged
| Cat.No. : | CHMP2B-1250H | 
| Product Overview : | Human CHMP2B full-length ORF (AAH01553.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 49.17 kDa | 
| AA Sequence : | MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CHMP2B charged multivesicular body protein 2B [ Homo sapiens ] | 
| Official Symbol | CHMP2B | 
| Synonyms | CHMP2B; charged multivesicular body protein 2B; chromatin modifying protein 2B; charged multivesicular body protein 2b; CHMP2.5; DKFZP564O123; VPS2 homolog B (S. cerevisiae); VPS2B; VPS2 homolog B; vacuolar protein-sorting-associated protein 2-2; DMT1; VPS2-2; DKFZp564O123; | 
| Gene ID | 25978 | 
| mRNA Refseq | NM_001244644 | 
| Protein Refseq | NP_001231573 | 
| UniProt ID | Q9UQN3 | 
| ◆ Recombinant Proteins | ||
| Chmp2b-2147M | Recombinant Mouse Chmp2b Protein, Myc/DDK-tagged | +Inquiry | 
| CHMP2B-1651M | Recombinant Mouse CHMP2B Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CHMP2B-4985H | Recombinant Human Chromatin Modifying Protein 2B, His-tagged | +Inquiry | 
| CHMP2B-1250H | Recombinant Human CHMP2B Protein, GST-Tagged | +Inquiry | 
| CHMP2B-11185H | Recombinant Human CHMP2B, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CHMP2B-185HCL | Recombinant Human CHMP2B lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP2B Products
Required fields are marked with *
My Review for All CHMP2B Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            