Recombinant Full Length Human CHMP4A Protein, GST-tagged
Cat.No. : | CHMP4A-3207HF |
Product Overview : | Human CHMP4A full-length ORF (ADR82892.1, 1 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 265 amino acids |
Description : | CHMP4A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 29.2 kDa |
AA Sequence : | MSRRRPEDGLGKAGPCVMRHHPPRSKAEVWRTLRGGGGRGELAMSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHMP4A charged multivesicular body protein 4A [ Homo sapiens ] |
Official Symbol | CHMP4A |
Synonyms | CHMP4A; charged multivesicular body protein 4A; C14orf123, chromatin modifying protein 4A, chromosome 14 open reading frame 123; charged multivesicular body protein 4a; HSPC134; VPS32A; chromatin modifying protein 4A; SNF7 homolog associated with Alix-2; Snf7 homologue associated with Alix 2; vacuolar protein sorting-associated protein 32-1; SNF7; CHMP4; SHAX2; CHMP4B; SNF7-1; VPS32-1; C14orf123; FLJ61658; MGC142093; MGC142095; |
Gene ID | 29082 |
mRNA Refseq | NM_014169 |
Protein Refseq | NP_054888 |
MIM | 610051 |
UniProt ID | Q9BY43 |
◆ Recombinant Proteins | ||
CHMP4A-1252H | Recombinant Human CHMP4A Protein, GST-Tagged | +Inquiry |
CHMP4A-1376H | Recombinant Human Charged Multivesicular Body Protein 4A, His-tagged | +Inquiry |
CHMP4A-1251H | Recombinant Human CHMP4A Protein | +Inquiry |
CHMP4A-3233H | Recombinant Human CHMP4A Protein, MYC/DDK-tagged | +Inquiry |
CHMP4A-3207HF | Recombinant Full Length Human CHMP4A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP4A-351HCL | Recombinant Human CHMP4A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP4A Products
Required fields are marked with *
My Review for All CHMP4A Products
Required fields are marked with *