Recombinant Full Length Human CHRNA3 Protein, GST-tagged
Cat.No. : | CHRNA3-3226HF |
Product Overview : | Human CHRNA3 full-length ORF (AAH06114.1, 1 a.a. - 489 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 489 amino acids |
Description : | This locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit, as it contains characteristic adjacent cysteine residues. The encoded protein is a ligand-gated ion channel that likely plays a role in neurotransmission. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2009] |
Molecular Mass : | 79.42 kDa |
AA Sequence : | MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEEQKAQEIQQLKRKEKSTETSDQEPGL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHRNA3 cholinergic receptor, nicotinic, alpha 3 (neuronal) [ Homo sapiens ] |
Official Symbol | CHRNA3 |
Synonyms | CHRNA3; cholinergic receptor, nicotinic, alpha 3 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 3; neuronal acetylcholine receptor subunit alpha-3; acetylcholine receptor; nicotinic; alpha 3 (neuronal); neuronal nicotinic acetylcholine receptor, alpha3 subunit; LNCR2; PAOD2; NACHRA3; MGC104879; |
Gene ID | 1136 |
mRNA Refseq | NM_000743 |
Protein Refseq | NP_000734 |
MIM | 118503 |
UniProt ID | P32297 |
◆ Recombinant Proteins | ||
CHRNA3-5986C | Recombinant Chicken CHRNA3 | +Inquiry |
CHRNA3-86H | Recombinant Human CHRNA3, His-tagged | +Inquiry |
CHRNA3-1723H | Recombinant Human CHRNA3 Protein (Ser32-Leu240), N-His tagged | +Inquiry |
CHRNA3-3226HF | Recombinant Full Length Human CHRNA3 Protein, GST-tagged | +Inquiry |
CHRNA3-2775H | Recombinant Human CHRNA3 Protein (32-240 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRNA3 Products
Required fields are marked with *
My Review for All CHRNA3 Products
Required fields are marked with *
0
Inquiry Basket