Recombinant Full Length Human CHRNA7 Protein, GST-tagged
Cat.No. : | CHRNA7-3240HF |
Product Overview : | Human CHRNA7 full-length ORF (AAH37571, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 321 amino acids |
Description : | The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012] |
Molecular Mass : | 61.05 kDa |
AA Sequence : | MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLSLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMITVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHRNA7 cholinergic receptor, nicotinic, alpha 7 (neuronal) [ Homo sapiens ] |
Official Symbol | CHRNA7 |
Synonyms | CHRNA7; cholinergic receptor, nicotinic, alpha 7 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 7; neuronal acetylcholine receptor subunit alpha-7; acetylcholine receptor; nicotinic; alpha 7 (neuronal); a7 nicotinic acetylcholine receptor; alpha-7 nicotinic cholinergic receptor subunit; alpha 7 neuronal nicotinic acetylcholine receptor; acetylcholine receptor, nicotinic, alpha 7 (neuronal); neuronal acetylcholine receptor protein, alpha-7 chain; NACHRA7; CHRNA7-2; |
Gene ID | 1139 |
mRNA Refseq | NM_000746 |
Protein Refseq | NP_000737 |
MIM | 118511 |
UniProt ID | P36544 |
◆ Recombinant Proteins | ||
CHRNA7-526H | Recombinant Human CHRNA7 protein, His-GST-tagged | +Inquiry |
CHRNA7-30390TH | Recombinant Human CHRNA7 | +Inquiry |
CHRNa7-3216R | Recombinant Rat CHRNa7 protein, His-tagged | +Inquiry |
CHRNA7-863R | Recombinant Rhesus monkey CHRNA7 Protein, His-tagged | +Inquiry |
CHRNA7-2674H | Recombinant Human CHRNA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA7-7514HCL | Recombinant Human CHRNA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA7 Products
Required fields are marked with *
My Review for All CHRNA7 Products
Required fields are marked with *