Recombinant Full Length Human CHRNA7 Protein, GST-tagged

Cat.No. : CHRNA7-3240HF
Product Overview : Human CHRNA7 full-length ORF (AAH37571, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 321 amino acids
Description : The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]
Molecular Mass : 61.05 kDa
AA Sequence : MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLSLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMITVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHRNA7 cholinergic receptor, nicotinic, alpha 7 (neuronal) [ Homo sapiens ]
Official Symbol CHRNA7
Synonyms CHRNA7; cholinergic receptor, nicotinic, alpha 7 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 7; neuronal acetylcholine receptor subunit alpha-7; acetylcholine receptor; nicotinic; alpha 7 (neuronal); a7 nicotinic acetylcholine receptor; alpha-7 nicotinic cholinergic receptor subunit; alpha 7 neuronal nicotinic acetylcholine receptor; acetylcholine receptor, nicotinic, alpha 7 (neuronal); neuronal acetylcholine receptor protein, alpha-7 chain; NACHRA7; CHRNA7-2;
Gene ID 1139
mRNA Refseq NM_000746
Protein Refseq NP_000737
MIM 118511
UniProt ID P36544

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNA7 Products

Required fields are marked with *

My Review for All CHRNA7 Products

Required fields are marked with *

0
cart-icon
0
compare icon