Recombinant Full Length Human CHST15 Protein, GST-tagged
| Cat.No. : | CHST15-5140HF |
| Product Overview : | Human GALNAC4S-6ST full-length ORF ( AAH27908, 1 a.a. - 561 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 561 amino acids |
| Description : | Chondroitin sulfate (CS) is a glycosaminoglycan which is an important structural component of the extracellular matrix and which links to proteins to form proteoglycans. Chondroitin sulfate E (CS-E) is an isomer of chondroitin sulfate in which the C-4 and C-6 hydroxyl groups are sulfated. This gene encodes a type II transmembrane glycoprotein that acts as a sulfotransferase to transfer sulfate to the C-6 hydroxal group of chondroitin sulfate. This gene has also been identified as being co-expressed with RAG1 in B-cells and as potentially acting as a B-cell surface signaling receptor. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012] |
| Molecular Mass : | 87.45 kDa |
| AA Sequence : | MRHCINCCIQLLPDGAHKQQVNCQGGPHHGHQACPTCKGENKILFRVDSKQMNLLAVLEVRTEGNENWGGFLRFKKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CHST15 carbohydrate sulfotransferase 15 [ Homo sapiens (human) ] |
| Official Symbol | CHST15 |
| Synonyms | CHST15; carbohydrate sulfotransferase 15; BRAG; GALNAC4S-6ST; carbohydrate sulfotransferase 15; B cell RAG associated protein (GALNAC4S-6ST); B-cell RAG-associated gene protein; carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15; hBRAG; EC 2.8.2.33 |
| Gene ID | 51363 |
| mRNA Refseq | NM_001270764 |
| Protein Refseq | NP_001257693 |
| MIM | 608277 |
| UniProt ID | Q7LFX5 |
| ◆ Recombinant Proteins | ||
| CHST15-3450M | Recombinant Mouse CHST15 Protein | +Inquiry |
| CHST15-5140HF | Recombinant Full Length Human CHST15 Protein, GST-tagged | +Inquiry |
| CHST15-1064R | Recombinant Rat CHST15 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHST15-11228H | Recombinant Human CHST15, GST-tagged | +Inquiry |
| CHST15-4686H | Recombinant Human CHST15 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHST15-2183HCL | Recombinant Human CHST15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST15 Products
Required fields are marked with *
My Review for All CHST15 Products
Required fields are marked with *
