Recombinant Full Length Human CIB2 Protein, GST-tagged
Cat.No. : | CIB2-1841HF |
Product Overview : | Human CIB2 full-length ORF (AAH47381.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 187 amino acids |
Description : | The protein encoded by this gene is similar to that of KIP/CIB, calcineurin B, and calmodulin. The encoded protein is a calcium-binding regulatory protein that interacts with DNA-dependent protein kinase catalytic subunits (DNA-PKcs), and it is involved in photoreceptor cell maintenance. Mutations in this gene cause deafness, autosomal recessive, 48 (DFNB48), and also Usher syndrome 1J (USH1J). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Molecular Mass : | 46.97 kDa |
AA Sequence : | MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CIB2 calcium and integrin binding family member 2 [ Homo sapiens ] |
Official Symbol | CIB2 |
Synonyms | CIB2; calcium and integrin binding family member 2; calcium and integrin-binding family member 2; KIP2; KIP 2; 2810434I23Rik; kinase-interacting protein 2; DNA-dependent protein kinase catalytic subunit-interacting protein 2 |
Gene ID | 10518 |
mRNA Refseq | NM_006383 |
Protein Refseq | NP_006374 |
MIM | 605564 |
UniProt ID | O75838 |
◆ Recombinant Proteins | ||
CIB2-1413R | Recombinant Rat CIB2 Protein | +Inquiry |
CIB2-1800H | Recombinant Human CIB2 protein, His-tagged | +Inquiry |
CIB2-10971Z | Recombinant Zebrafish CIB2 | +Inquiry |
CIB2-27244TH | Recombinant Human CIB2, His-tagged | +Inquiry |
CIB2-1841HF | Recombinant Full Length Human CIB2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIB2-7498HCL | Recombinant Human CIB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CIB2 Products
Required fields are marked with *
My Review for All CIB2 Products
Required fields are marked with *
0
Inquiry Basket