Recombinant Full Length Human CISD1 Protein, C-Flag-tagged

Cat.No. : CISD1-2118HFL
Product Overview : Recombinant Full Length Human CISD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 12 kDa
AA Sequence : MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAV YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Transmembrane
Full Length : Full L.
Gene Name CISD1 CDGSH iron sulfur domain 1 [ Homo sapiens (human) ]
Official Symbol CISD1
Synonyms ZCD1; MDS029; C10orf70; mitoNEET
Gene ID 55847
mRNA Refseq NM_018464.5
Protein Refseq NP_060934.1
MIM 611932
UniProt ID Q9NZ45

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CISD1 Products

Required fields are marked with *

My Review for All CISD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon