Recombinant Full Length Human CISD1 Protein, C-Flag-tagged
Cat.No. : | CISD1-2118HFL |
Product Overview : | Recombinant Full Length Human CISD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 12 kDa |
AA Sequence : | MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAV YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | CISD1 CDGSH iron sulfur domain 1 [ Homo sapiens (human) ] |
Official Symbol | CISD1 |
Synonyms | ZCD1; MDS029; C10orf70; mitoNEET |
Gene ID | 55847 |
mRNA Refseq | NM_018464.5 |
Protein Refseq | NP_060934.1 |
MIM | 611932 |
UniProt ID | Q9NZ45 |
◆ Recombinant Proteins | ||
CISD1-3481M | Recombinant Mouse CISD1 Protein | +Inquiry |
CISD1-258H | Recombinant Human CISD1, His-tagged | +Inquiry |
CISD1-1697M | Recombinant Mouse CISD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CISD1-7153H | Recombinant Human CDGSH Iron Sulfur Domain 1, His-tagged | +Inquiry |
CISD1-4365C | Recombinant Chicken CISD1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CISD1-7490HCL | Recombinant Human CISD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CISD1 Products
Required fields are marked with *
My Review for All CISD1 Products
Required fields are marked with *
0
Inquiry Basket