Recombinant Full Length Human CKMT1B Protein, GST-tagged
| Cat.No. : | CKMT1B-1866HF | 
| Product Overview : | Human CKMT1B full-length ORF ( NP_066270.1, 1 a.a. - 417 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 417 amino acids | 
| Description : | Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 73.4 kDa | 
| AA Sequence : | MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CKMT1B creatine kinase, mitochondrial 1B [ Homo sapiens ] | 
| Official Symbol | CKMT1B | 
| Synonyms | CKMT1B; creatine kinase, mitochondrial 1B; CKMT, CKMT1, creatine kinase, mitochondrial 1 (ubiquitous); creatine kinase U-type, mitochondrial; UMTCK; U-MtCK; mia-CK; ubiquitous mitochondrial creatine kinase; acidic-type mitochondrial creatine kinase; creatine kinase, mitochondrial 1 (ubiquitous); CKMT; CKMT1; CKMT1A | 
| Gene ID | 1159 | 
| mRNA Refseq | NM_020990 | 
| Protein Refseq | NP_066270 | 
| MIM | 123290 | 
| UniProt ID | P12532 | 
| ◆ Recombinant Proteins | ||
| CKMT1B-1399H | Recombinant Human CKMT1B Protein, GST-tagged | +Inquiry | 
| CKMT1B-2713H | Recombinant Human CKMT1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| CKMT1B-1866HF | Recombinant Full Length Human CKMT1B Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CKMT1B-7482HCL | Recombinant Human CKMT1B 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKMT1B Products
Required fields are marked with *
My Review for All CKMT1B Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            