Recombinant Full Length Human CLCF1 Protein, GST-tagged
| Cat.No. : | CLCF1-1964HF |
| Product Overview : | Human CLCF1 full-length ORF ( AAH12939, 29 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 225 amino acids |
| Description : | This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor (CNTF) for binding to the ciliary neurotrophic factor receptor (CNTFR) complex, and activates the Jak-STAT signaling cascade. CLCF1 can be actively secreted from cells by forming a complex with soluble type I CRLF1 or soluble CNTFR. CLCF1 is a potent neurotrophic factor, B-cell stimulatory agent and neuroendocrine modulator of pituitary corticotroph function. Defects in CLCF1 cause cold-induced sweating syndrome 2 (CISS2). This syndrome is characterized by a profuse sweating after exposure to cold as well as congenital physical abnormalities of the head and spine. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2009] |
| Molecular Mass : | 47.41 kDa |
| AA Sequence : | NRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLCF1 cardiotrophin-like cytokine factor 1 [ Homo sapiens ] |
| Official Symbol | CLCF1 |
| Synonyms | CLCF1; cardiotrophin-like cytokine factor 1; CRLF1 associated cytokine like factor 1; B cell stimulating factor 3; BSF 3; BSF3; CISS2; CLC; cold induced sweating syndrome 2; NNT 1; NNT1; novel neurotrophin 1; NR6; novel neurotrophin-1; B-cell stimulating factor 3; B-cell stimulatory factor 3; B-cell-stimulating factor 3; CRLF1 associated cytokine-like factor 1; neurotrophin-1/B-cell stimulating factor-3; BSF-3; NNT-1 |
| Gene ID | 23529 |
| mRNA Refseq | NM_001166212 |
| Protein Refseq | NP_001159684 |
| MIM | 607672 |
| UniProt ID | Q9UBD9 |
| ◆ Recombinant Proteins | ||
| CLCF1-618H | Recombinant Human CLCF1 Protein, His-tagged | +Inquiry |
| CLCF1-2065H | Recombinant Human CLCF1 Protein (Leu28-Phe225), N-His tagged | +Inquiry |
| CLCF1-351H | Recombinant Human CLCF1, Fc-tagged | +Inquiry |
| CLCF1-1413H | Recombinant Human CLCF1 Protein, GST-tagged | +Inquiry |
| CLCF1-29299TH | Recombinant Human CLCF1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLCF1-001HCL | Recombinant Human CLCF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLCF1 Products
Required fields are marked with *
My Review for All CLCF1 Products
Required fields are marked with *
