Recombinant Full Length Human CLDN22 Protein, C-Flag-tagged
Cat.No. : | CLDN22-159HFL |
Product Overview : | Recombinant Full Length Human CLDN22 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is intronless and overlaps the 3' UTR of the WWC2 gene (GeneID: 80014) on the opposite strand. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.3 kDa |
AA Sequence : | MALVFRTVAQLAGVSLSLLGWVLSCLTNYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEVGMQCKDFDSF LALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLILGGILSWASGVTALVPVSWV AHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLHCAACSSHAPLASGHYAVAQTQDHHQE LETRNTNLKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction |
Full Length : | Full L. |
Gene Name | CLDN22 claudin 22 [ Homo sapiens (human) ] |
Official Symbol | CLDN22 |
Synonyms | CLDN21 |
Gene ID | 53842 |
mRNA Refseq | NM_001111319.3 |
Protein Refseq | NP_001104789.1 |
UniProt ID | Q8N7P3 |
◆ Recombinant Proteins | ||
CLDN22-720R | Recombinant Rhesus Macaque CLDN22 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN22-142H | Recombinant Human CLDN22 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLDN22-159HFL | Recombinant Full Length Human CLDN22 Protein, C-Flag-tagged | +Inquiry |
CLDN22-610H | Recombinant Human CLDN22 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN22-894R | Recombinant Rhesus monkey CLDN22 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN22 Products
Required fields are marked with *
My Review for All CLDN22 Products
Required fields are marked with *
0
Inquiry Basket