Recombinant Full Length Human CLDN24 Protein, C-Flag-tagged
| Cat.No. : | CLDN24-189HFL |
| Product Overview : | Recombinant Full Length Human CLDN24 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is 75% identical to the mouse homolog. This gene is upstream of the CLDN22 gene, which overlaps the WWC2 gene on the opposite strand in the genome. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 24.9 kDa |
| AA Sequence : | MALIFRTAMQSVGLLLSLLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEVGMQCKDFDSF LALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLILGGILSWASGITALVPVSWV AHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLNCAACSSHAPLALGHYAVAQMQTQCPY LEDGTADPQVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | CLDN24 claudin 24 [ Homo sapiens (human) ] |
| Official Symbol | CLDN24 |
| Synonyms | CLDN21 |
| Gene ID | 100132463 |
| mRNA Refseq | NM_001185149.1 |
| Protein Refseq | NP_001172078.1 |
| UniProt ID | A6NM45 |
| ◆ Recombinant Proteins | ||
| CLDN24-3243H | Recombinant Human CLDN24 Protein, MYC/DDK-tagged | +Inquiry |
| RFL26156HF | Recombinant Full Length Human Putative Claudin-24(Cldn24) Protein, His-Tagged | +Inquiry |
| CLDN24-611H | Recombinant Human CLDN24 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLDN24-189HFL | Recombinant Full Length Human CLDN24 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN24 Products
Required fields are marked with *
My Review for All CLDN24 Products
Required fields are marked with *
