Recombinant Full Length Human Putative Claudin-24(Cldn24) Protein, His-Tagged
Cat.No. : | RFL26156HF |
Product Overview : | Recombinant Full Length Human Putative claudin-24(CLDN24) Protein (A6NM45) (1-205aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-205) |
Form : | Lyophilized powder |
AA Sequence : | MALIFRTAMQSVGLLLSLLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEV GMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLI LGGILSWASGITALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGG CLLNCAACSSHAPLALGHYAVAQMQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CLDN24 |
Synonyms | CLDN24; CLDN21; Putative claudin-24; Claudin-21 |
UniProt ID | A6NM45 |
◆ Recombinant Proteins | ||
RFL26156HF | Recombinant Full Length Human Putative Claudin-24(Cldn24) Protein, His-Tagged | +Inquiry |
CLDN24-3243H | Recombinant Human CLDN24 Protein, MYC/DDK-tagged | +Inquiry |
CLDN24-611H | Recombinant Human CLDN24 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN24-189HFL | Recombinant Full Length Human CLDN24 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN24 Products
Required fields are marked with *
My Review for All CLDN24 Products
Required fields are marked with *
0
Inquiry Basket