Recombinant Full Length Human CLDN6 Protein, GST-tagged
| Cat.No. : | CLDN6-2060HF |
| Product Overview : | Human CLDN6 full-length ORF ( NP_067018.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 220 amino acids |
| Description : | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. This gene encodes a component of tight junction strands, which is a member of the claudin family. The protein is an integral membrane protein and is one of the entry cofactors for hepatitis C virus. The gene methylation may be involved in esophageal tumorigenesis. This gene is adjacent to another family member CLDN9 on chromosome 16.[provided by RefSeq, Aug 2010] |
| Molecular Mass : | 49.7 kDa |
| AA Sequence : | MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAVIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLDN6 claudin 6 [ Homo sapiens ] |
| Official Symbol | CLDN6 |
| Synonyms | CLDN6; claudin 6; claudin-6; skullin |
| Gene ID | 9074 |
| mRNA Refseq | NM_021195 |
| Protein Refseq | NP_067018 |
| MIM | 615798 |
| UniProt ID | P56747 |
| ◆ Recombinant Proteins | ||
| CLDN6-139H | Active Recombinant Human CLDN6 protein, His-strep-tagged | +Inquiry |
| CLDN6-4322H | Recombinant Human CLDN6 Full Length Transmembrane protein(VLPs) | +Inquiry |
| CLDN6-137H | Recombinant Human CLDN6 protein | +Inquiry |
| CLDN6-0193H | Recombinant Human CLDN6 Full Length Transmembrane protein, GFP-tagged | +Inquiry |
| CLDN6-862C | Active Recombinant Cynomolgus CLDN6 Full Length Transmembrane protein(VLPs) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLDN6-7460HCL | Recombinant Human CLDN6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN6 Products
Required fields are marked with *
My Review for All CLDN6 Products
Required fields are marked with *
