Recombinant Full Length Human CLEC11A Protein, GST-tagged
Cat.No. : | CLEC11A-2114HF |
Product Overview : | Human CLEC11A full-length ORF (BAG36831.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 323 amino acids |
Description : | This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 61.93 kDa |
AA Sequence : | MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLEC11A C-type lectin domain family 11, member A [ Homo sapiens ] |
Official Symbol | CLEC11A |
Synonyms | CLEC11A; C-type lectin domain family 11, member A; SCGF, stem cell growth factor; lymphocyte secreted C type lectin; C-type lectin domain family 11 member A; CLECSF3; LSLCL; P47; stem cell growth factor; lymphocyte secreted C-type lectin; C-type lectin superfamily member 3; lymphocyte secreted long form of C-type lectin; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 3; SCGF |
Gene ID | 6320 |
mRNA Refseq | NM_002975 |
Protein Refseq | NP_002966 |
MIM | 604713 |
UniProt ID | Q9Y240 |
◆ Recombinant Proteins | ||
CLEC11A-3546M | Recombinant Mouse CLEC11A Protein | +Inquiry |
CLEC11A-1204H | Recombinant Human C-Type Lectin Domain Family 11, Member A | +Inquiry |
CLEC11A-1409H | Recombinant Human C-type Lectin Domain Family 11, Member A | +Inquiry |
CLEC11A-1453H | Recombinant Human CLEC11A Protein, GST-tagged | +Inquiry |
CLEC11A-30960TH | Recombinant Human CLEC11A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC11A Products
Required fields are marked with *
My Review for All CLEC11A Products
Required fields are marked with *