Recombinant Full Length Human CLEC3A Protein, GST-tagged

Cat.No. : CLEC3A-2134HF
Product Overview : Human CLEC3A full-length ORF ( NP_005743.2, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 197 amino acids
Description : CLEC3A (C-Type Lectin Domain Family 3 Member A) is a Protein Coding gene. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is CLEC3B.
Molecular Mass : 48.6 kDa
AA Sequence : MAKNGLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKEIQALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFTIPK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLEC3A C-type lectin domain family 3, member A [ Homo sapiens ]
Official Symbol CLEC3A
Synonyms C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 1 (cartilage-derived); C-type lectin domain family 3 member A; C-type lectin superfamily member 1; Cartilage-derived C-type lectin; CLC3A_HUMAN; Clec3a; CLECSF1
Gene ID 10143
mRNA Refseq NM_005752.4
Protein Refseq NP_005743.4
MIM 613588
UniProt ID J3KNC9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC3A Products

Required fields are marked with *

My Review for All CLEC3A Products

Required fields are marked with *

0
cart-icon