Recombinant Full Length Human CLEC3A Protein, GST-tagged

• Cat.No.: CLEC3A-2134HF
• Product Overview: Human CLEC3A full-length ORF ( NP_005743.2, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 197 amino acids
• Description: CLEC3A (C-Type Lectin Domain Family 3 Member A) is a Protein Coding gene. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is CLEC3B.
• Molecular Mass: 48.6 kDa
• AA Sequence: MAKNGLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKEIQALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFTIPK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLEC3A C-type lectin domain family 3, member A [ Homo sapiens ]
• Official Symbol: CLEC3A
• Synonyms: C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 1 (cartilage-derived); C-type lectin domain family 3 member A; C-type lectin superfamily member 1; Cartilage-derived C-type lectin; CLC3A_HUMAN; Clec3a; CLECSF1
• Gene ID: 10143
• mRNA Refseq: NM_005752.4
• Protein Refseq: NP_005743.4
• MIM: 613588
• UniProt ID: J3KNC9