Recombinant Human CLEC3A Protein, GST-tagged
Cat.No. : | CLEC3A-1465H |
Product Overview : | Human CLEC3A full-length ORF ( NP_005743.2, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CLEC3A (C-Type Lectin Domain Family 3 Member A) is a Protein Coding gene. GO annotations related to this gene include carbohydrate binding. An important paralog of this gene is CLEC3B. |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MAKNGLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKEIQALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFTIPK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLEC3A C-type lectin domain family 3, member A [ Homo sapiens ] |
Official Symbol | CLEC3A |
Synonyms | C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 1 (cartilage-derived); C-type lectin domain family 3 member A; C-type lectin superfamily member 1; Cartilage-derived C-type lectin; CLC3A_HUMAN; Clec3a; CLECSF1; |
Gene ID | 10143 |
mRNA Refseq | NM_005752.4 |
Protein Refseq | NP_005743.4 |
MIM | 613588 |
UniProt ID | J3KNC9 |
◆ Recombinant Proteins | ||
CLEC3A-2134HF | Recombinant Full Length Human CLEC3A Protein, GST-tagged | +Inquiry |
CLEC3A-4997C | Recombinant Chicken CLEC3A | +Inquiry |
CLEC3A-1465H | Recombinant Human CLEC3A Protein, GST-tagged | +Inquiry |
CLEC3A-833M | Recombinant Mouse CLEC3A protein, His-tagged | +Inquiry |
CLEC3A-11313H | Recombinant Human CLEC3A, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC3A-7451HCL | Recombinant Human CLEC3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC3A Products
Required fields are marked with *
My Review for All CLEC3A Products
Required fields are marked with *