Recombinant Full Length Human CLEC3B Protein, GST-tagged
Cat.No. : | CLEC3B-2135HF |
Product Overview : | Human CLEC3B full-length ORF ( AAH11024, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 202 amino acids |
Description : | CLEC3B (C-Type Lectin Domain Family 3 Member B) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+. GO annotations related to this gene include calcium ion binding and heparin binding. An important paralog of this gene is CLEC3A. |
Molecular Mass : | 47.96 kDa |
AA Sequence : | MEVWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNGMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLEC3B C-type lectin domain family 3, member B [ Homo sapiens ] |
Official Symbol | CLEC3B |
Synonyms | CLEC3B; C-type lectin domain family 3, member B; tetranectin (plasminogen binding protein) , TNA; tetranectin; TN; plasminogen kringle 4-binding protein; tetranectin (plasminogen binding protein); tetranectin (plasminogen-binding protein); TNA; DKFZp686H17246 |
Gene ID | 7123 |
mRNA Refseq | NM_003278 |
Protein Refseq | NP_003269 |
MIM | 187520 |
UniProt ID | P05452 |
◆ Recombinant Proteins | ||
CLEC3B-183H | Recombinant Human CLEC3B Protein, His-tagged | +Inquiry |
CLEC3B-6232C | Recombinant Chicken CLEC3B | +Inquiry |
CLEC3B-1466H | Recombinant Human CLEC3B Protein, GST-tagged | +Inquiry |
CLEC3B-1621H | Recombinant Human CLEC3B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLEC3B-2210H | Recombinant Human CLEC3B Protein (Glu22-Val202), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC3B-1889HCL | Recombinant Human CLEC3B cell lysate | +Inquiry |
CLEC3B-1552MCL | Recombinant Mouse CLEC3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC3B Products
Required fields are marked with *
My Review for All CLEC3B Products
Required fields are marked with *