Recombinant Full Length Human CLEC3B Protein, GST-tagged

Cat.No. : CLEC3B-2135HF
Product Overview : Human CLEC3B full-length ORF ( AAH11024, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 202 amino acids
Description : CLEC3B (C-Type Lectin Domain Family 3 Member B) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+. GO annotations related to this gene include calcium ion binding and heparin binding. An important paralog of this gene is CLEC3A.
Molecular Mass : 47.96 kDa
AA Sequence : MEVWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNGMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLEC3B C-type lectin domain family 3, member B [ Homo sapiens ]
Official Symbol CLEC3B
Synonyms CLEC3B; C-type lectin domain family 3, member B; tetranectin (plasminogen binding protein) , TNA; tetranectin; TN; plasminogen kringle 4-binding protein; tetranectin (plasminogen binding protein); tetranectin (plasminogen-binding protein); TNA; DKFZp686H17246
Gene ID 7123
mRNA Refseq NM_003278
Protein Refseq NP_003269
MIM 187520
UniProt ID P05452

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC3B Products

Required fields are marked with *

My Review for All CLEC3B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon