Recombinant Human CLEC3B Protein, His-tagged

• Cat.No.: CLEC3B-183H
• Product Overview: Recombinant human CLEC3B protein with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 202
• Description: Enables calcium ion binding activity; heparin binding activity; and kringle domain binding activity. Involved in bone mineralization and cellular response to transforming growth factor beta stimulus. Located in cytoplasm; extracellular space; and granular component. Part of collagen-containing extracellular matrix. Implicated in osteoarthritis.
• Form: Lyophilized
• Molecular Mass: 21 kDa
• AA Sequence: MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CLEC3B C-type lectin domain family 3, member B [ Homo sapiens (human) ]
• Official Symbol: CLEC3B
• Synonyms: CLEC3B; C-type lectin domain family 3, member B; tetranectin (plasminogen binding protein) , TNA; tetranectin; TN; plasminogen kringle 4-binding protein; tetranectin (plasminogen binding protein); tetranectin (plasminogen-binding protein); TNA; DKFZp686H17246
• Gene ID: 7123
• mRNA Refseq: NM_003278
• Protein Refseq: NP_003269
• MIM: 187520
• UniProt ID: P05452