Recombinant Human CLEC3B Protein, His-tagged
Cat.No. : | CLEC3B-183H |
Product Overview : | Recombinant human CLEC3B protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 202 |
Description : | Enables calcium ion binding activity; heparin binding activity; and kringle domain binding activity. Involved in bone mineralization and cellular response to transforming growth factor beta stimulus. Located in cytoplasm; extracellular space; and granular component. Part of collagen-containing extracellular matrix. Implicated in osteoarthritis. |
Form : | Lyophilized |
Molecular Mass : | 21 kDa |
AA Sequence : | MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CLEC3B C-type lectin domain family 3, member B [ Homo sapiens (human) ] |
Official Symbol | CLEC3B |
Synonyms | CLEC3B; C-type lectin domain family 3, member B; tetranectin (plasminogen binding protein) , TNA; tetranectin; TN; plasminogen kringle 4-binding protein; tetranectin (plasminogen binding protein); tetranectin (plasminogen-binding protein); TNA; DKFZp686H17246; |
Gene ID | 7123 |
mRNA Refseq | NM_003278 |
Protein Refseq | NP_003269 |
MIM | 187520 |
UniProt ID | P05452 |
◆ Recombinant Proteins | ||
Clec3b-2185M | Recombinant Mouse Clec3b Protein, Myc/DDK-tagged | +Inquiry |
CLEC3B-6912H | Recombinant Human CLEC3B protein, His-tagged | +Inquiry |
CLEC3B-6232C | Recombinant Chicken CLEC3B | +Inquiry |
CLEC3B-2211H | Recombinant Human CLEC3B Protein (Glu22-Val202), N-His tagged | +Inquiry |
CLEC3B-1466H | Recombinant Human CLEC3B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC3B-1552MCL | Recombinant Mouse CLEC3B cell lysate | +Inquiry |
CLEC3B-1889HCL | Recombinant Human CLEC3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC3B Products
Required fields are marked with *
My Review for All CLEC3B Products
Required fields are marked with *